TYOBP_MOUSE O54885
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O54885
Recommended name：TYRO protein tyrosine kinase-binding protein
EC number：
Alternative names：(DNAX-activation protein 12) (Killer-activating receptor-associated protein) (KAR-associated protein)
Cleaved into：
GeneID：22177
Gene names (primary )：Tyrobp
Gene names (synonym )：Dap12 Karap
Gene names (ORF )：
Length：114
Mass：12367
Sequence：MGALEPSWCLLFLPVLLTVGGLSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR
Tissue specificity：Expressed on microglia (at protein level) (PubMed:12569157, PubMed:18685038). Expressed on oligodendrocytes (at protein level) (PubMed:12569157). Expressed on macrophages and osteoclasts (PubMed:14969392). Expressed on dendritic cells in liver, spleen, kidney and lung with highest levels in liver dendritic cells (PubMed:21257958). {ECO:0000269|PubMed:12569157, ECO:0000269|PubMed:14969392, ECO:0000269|PubMed:18685038, ECO:0000269|PubMed:21257958}.
Induction：Induced in microglia following nerve injury (at protein level) (PubMed:25690660). Induced in liver dendritic cells by physiological concentrations of lipopolysaccharide (PubMed:21257958). {ECO:0000269|PubMed:21257958, ECO:0000269|PubMed:25690660}.
Developmental stage：
Protein families：TYROBP family