ITL1B_MOUSE Q80ZA0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80ZA0
Recommended name：Intelectin-1b
EC number：
Alternative names：(Intelectin-2)
Cleaved into：
GeneID：493583
Gene names (primary )：Itln1b
Gene names (synonym )：Itln2 Itlnb
Gene names (ORF )：
Length：313
Mass：35070
Sequence：MTQLGFLLFIMIATRVCSAAEENLDTNRWGNSFFSSLPRSCKEIKQEDTKAQDGLYFLRTENGVIYQTFCDMTTAGGGWTLVASVHENNLRGRCTVGDRWSSQQGNRADYPEGDGNWANYNTFGSAEGATSDDYKNPGYFDIQAENLGIWHVPNNSPLHTWRNSSLLRYRTFTGFLQRLGHNLFGLYQKYPVKYGEGKCWTDNGPAFPVVYDFGDAQKTASYYSPSGRNEFTAGYVQFRVFNNERAASALCAGVRVTGCNTEHHCIGGGGFFPEFDPEECGDFAAFDANGYGTHIRYSNSREITEAAVLLFYR
Tissue specificity：Expressed in the globlet and Paneth cells of the small intestine of infected mice. Expressed in the ileum of uninfected mice.
Induction：Up-regulated by infection with T.spiralis (at protein level). Also induced by infection with the helminth parasite N.brasiliensis. {ECO:0000269|PubMed:15048991, ECO:0000269|PubMed:15265922, ECO:0000269|PubMed:17420014}.
Developmental stage：
Protein families：