U17PB_MOUSE E9Q9U0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:E9Q9U0
Recommended name：Ubiquitin carboxyl-terminal hydrolase 17-like protein B
EC number：EC 3.4.19.12
Alternative names：(USP17-B) (Deubiquitinating enzyme 1A)
Cleaved into：
GeneID：381944
Gene names (primary )：Usp17lb
Gene names (synonym )：Dub1a
Gene names (ORF )：
Length：468
Mass：52114
Sequence：MVVALSFPEADPAMSPPSAPELHQDEAQVVEELAANGKHSLSWESPQGPGCGLQNTGNSCYLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKMCAMEAHVTQSLLHTHSGDVMKPSQNLTSAFHKRKQEDAHEFLMFTLETMHESCLQVHRQSEPTSEDSSPIHDIFGGWWRSQIKCHHCQGTSYSYDPFLDIPLDISSVQSVKQALQDTEKAEELCGENSYYCGRCRQKKPASKTLKLYSAPKVLMLVLKRFSGSMGKKLDRKVSYPEFLDLKPYLSQPTGGPLPYALYAVLVHEGATCHSGHYFCCVKAGHGKWYKMDDTKVTSCDVTSVLNENAYVLFYVQQNDLKKGSINMPEGRIHEVLDAKYQLKKSGEKKHNKSPCTEDAGEPCENREKRSSKETSLGEGKVLQEQDHQKAGQKQENTKLTPQEQNHEKGGQNLRNTEGELDRLSGAIVVYQPICTAN
Tissue specificity：Detected in brain, heart, liver, lung, kidney, ovary and spleen. {ECO:0000269|PubMed:14583620}.
Induction：Up-regulated by interleukin-3 (IL-3) in the B-lymphocyte cell line Ba/F3. May also be up-regulated in response to JAK2. {ECO:0000269|PubMed:14583620}.
Developmental stage：
Protein families：Peptidase C19 family, USP17 subfamily