SHB_MOUSE   Q6PD21


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6PD21

Recommended name:SH2 domain-containing adapter protein B

EC number:

Alternative names:

Cleaved into:

GeneID:230126

Gene names  (primary ):Shb

Gene names  (synonym ):

Gene names  (ORF ):

Length:503

Mass:54708

Sequence:MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERREQPPQAVPQACSASSASCGSAAACFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGGGGGDPGGGQRAFTAAAGAAGCCCAAAGAGAAASSSSSSGSPHLYRSSSERRPTTPAEVRYISPKHRLIKVESASAAGDPPGGVCSGGRTWSPTTCGGKKLLNKCSAEETGAGQKDKVTIADDYSDPFDAKSDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSLRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPTIPLEKQIWYHGAISRSDAENLLRLCKECSYLVRNSQTSKHDYSLSLKSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Tissue specificity:Expressed in heart, liver, brain and kidney (at protein level). {ECO:0000269|PubMed:8302579}.

Induction:Up-regulated by okadaic acid and genistein. {ECO:0000269|PubMed:8777141}.

Developmental stage:

Protein families:


   💬 WhatsApp