BATF_MOUSE O35284
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35284
Recommended name：Basic leucine zipper transcriptional factor ATF-like
EC number：
Alternative names：(B-cell-activating transcription factor) (B-ATF)
Cleaved into：
GeneID：53314
Gene names (primary )：Batf
Gene names (synonym )：
Gene names (ORF )：
Length：125
Mass：14065
Sequence：MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP
Tissue specificity：Detected in postnatal and adult lymphoid tissues such as thymus, spleen and lymph nodes. In thymus most concentrated expression is found in the immediate cortical layer. Differentially expressed during T-cell development in thymus. Highly expressed in Th17, Th1 and Th2 cells and in activated B-cells. {ECO:0000269|PubMed:11466704, ECO:0000269|PubMed:19578362, ECO:0000269|PubMed:20421391}.
Induction：Up-regulated by STAT3 in response to DNA damage. Induces by IL12 at late effector stage. Down-regulated by STAT5 in follicular T-helper cells (TfH). {ECO:0000269|PubMed:12444555, ECO:0000269|PubMed:21873234, ECO:0000269|PubMed:22318729, ECO:0000269|PubMed:22385964}.
Developmental stage：
Protein families：BZIP family