SYAP1_MOUSE Q9D5V6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D5V6
Recommended name：Synapse-associated protein 1
EC number：
Alternative names：(BSD domain-containing signal transducer and Akt interactor protein) (BSTA)
Cleaved into：
GeneID：67043
Gene names (primary )：Syap1
Gene names (synonym )：
Gene names (ORF )：
Length：365
Mass：41350
Sequence：MFGGLSSWLGLKPPEGAAAEGEEPPSRDGDKLSAGAAPSEESPERPVEPTEEQQQQPPTEDPQFLHQAKGLGNYLYNFASAATKKITESVTETAQTIKKSVEEGKIDDILDKTILGDFQKEQKKFVEEQNTKKSEAAVPPWVESHDEETIQQQILALSADKRNFLRDPPAGVQFNFDFDQMYPVALVMLQEDELLSKMRFALVPKLVKEEVFWRNYFYRISLIKQSAQLTALAAQQQASGKEEKSSNRDDNLPLTEAVRPKTPPVVIKSQLKSQEDEEEISTSPGVSEFVSDAFDTCSLNQEDLRKEMEQLVLDKKQEEATALEEDSTDWEKELQQELQEYEVVAESEKRDENWDKEIEKMLQES
Tissue specificity：Expressed in the liver, kidney, skeletal muscle and in white and brown adipose tissues (PubMed:23300339, PubMed:27344443). Expressed in the cortex, cerebellum, thalamus, hippocampus, braistem, olfactory bulb, spinal cord and striatum of the brain (PubMed:27344443). Expressed in most neuropil regions containing glutamatergic synaptic terminals (PubMed:27344443). Expressed in the CA1, CA2 and CA3 perikarya of the hippocampus (PubMed:27344443). Expressed in neurons and Purkinje cells (at the protein level) (PubMed:27344443). {ECO:0000269|PubMed:23300339, ECO:0000269|PubMed:27344443}.
Induction：Up-regulated during adipocyte differentiation (at protein level) (PubMed:23300339). {ECO:0000269|PubMed:23300339}.
Developmental stage：
Protein families：