DPEP2_MOUSE Q8C255
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C255
Recommended name：Dipeptidase 2
EC number：EC 3.4.13.19
Alternative names：(Membrane-bound dipeptidase 2) (MBD-2)
Cleaved into：
GeneID：319446
Gene names (primary )：Dpep2
Gene names (synonym )：Mbd2
Gene names (ORF )：
Length：478
Mass：52664
Sequence：MSLTGLKGHWVLGHGLSVFLLVLLLLGPSQPLIWTQTKPGFSGASTTSSIPRALTKPDISSIPTTPGNPNFPDLRDRARALMQEFPLIDGHNDMPLVLRQFYQNGLQDANLRNFTHGQTSLDRLKDGLVGAQFWSAYVPCQTQDRDALRLTLEQIDLIRRICASYSELELVTSVKALNSTQKLACLIGVEGGHSLDNSLAVLRSFYLLGVRYLTLTHTCNTPWAETSSKGVHAFYSSVTGLTSFGEKVVAEMNRLGMMVDLSHVSDAAARRALEVSQAPVIFSHSAARAVCPNARNLPDDLLQLLKKNGGIVMVTFSVGVLPCNPLANVSTVADHFDHIRSVIGSEFIGIGGDYDGTKQFPQGLEDVSTYPVLIEELLRRGWNEQELQGILRGNLLRVFRQVEQVRDKSKWQSPLEDMIPEEQLDSACHSALRPQKQHPEKNQPETPEYHILKFSHSKSSPHIVPSLAIVATLLGLIV
Tissue specificity：Expressed in heart, lung, testis, spleen and skeletal muscle. Not detected in kidney and brain. {ECO:0000269|PubMed:12738806}.
Induction：Up-regulated during CVB3-induced viral myocarditis in the cardiac infiltrating macrophages. {ECO:0000269|PubMed:30899700}.
Developmental stage：
Protein families：Metallo-dependent hydrolases superfamily, Peptidase M19 family