PP13G_MOUSE Q9CW07
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CW07
Recommended name：Protein phosphatase 1 regulatory subunit 3G
EC number：
Alternative names：
Cleaved into：
GeneID：76487
Gene names (primary )：Ppp1r3g
Gene names (synonym )：
Gene names (ORF )：
Length：347
Mass：37823
Sequence：MDPSGEQLHRSEASSSTSSGDPQSAEELSVPEVLCVESGTSETPIPDAQLQDRPLSPQKGAALPEQEELQEYRRSRARSFSLPADPILQAAKLLQQRQQAGQPSSEGGAPAGDCCSKCKKRVQFADSLGLSLASVKHFSEAEEPQVPPAVLSRLHSFPLRAEDLQQLGGLLAVATMPDPLLVPCARLRPHFQLPELRAAEERLRRQRVCLERVQCSQPPRAEVTGSGRVISCPGPRAVAVRYTFTEWRTFLDVPAELDPESVEPLPPLQSGDSGSKAEDSEEGPGTERFHFSLCLPPGLQPKEGEDAGAWGVAIHFAVCYRCEQGEYWDNNEGANYTLRYVCSTDPL
Tissue specificity：
Induction：Up-regulated during fasting and down-regulated after feeding. {ECO:0000269|PubMed:21471512}.
Developmental stage：
Protein families：