RHOA_MOUSE   Q9QUI0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QUI0

Recommended name:Transforming protein RhoA

EC number:EC 3.6.5.2

Alternative names:

Cleaved into:

GeneID:11848

Gene names  (primary ):Rhoa

Gene names  (synonym ):Arha Arha2

Gene names  (ORF ):

Length:193

Mass:21782

Sequence:MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLIL

Tissue specificity:

Induction:Up-regulated during keratinocyte differentiation. {ECO:0000269|PubMed:11777936}.

Developmental stage:

Protein families:Small GTPase superfamily, Rho family


   💬 WhatsApp