LRC18_MOUSE Q9CQ07
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQ07
Recommended name：Leucine-rich repeat-containing protein 18
EC number：
Alternative names：(Testis-specific LRR protein)
Cleaved into：
GeneID：67580
Gene names (primary )：Lrrc18
Gene names (synonym )：Mtlr1
Gene names (ORF )：
Length：262
Mass：29520
Sequence：MAKGGKGPKGKKITLNVAKNCIKITFDGRKRLDLSKMGITTFPKCILRLSDIDELDLSRNMIRKIPDSIAKFQNLRWLDLHSNYIDKLPESIGQMTSLLFLNVSNNRLTTNGLPVELNQLKNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLTTIPASIAKLPKLKKLNIKRNPFPNADESEMFVDSIKRLENLYLVEEKDMCSSCLQRCQQARDKLNKIKSMAPSAPRKALFSNLVSPNSTAKDAQEEWRLRSPSTF
Tissue specificity：Exclusively expressed in spermatocytes and roud spermatids within seminiferous tubules during spermatogenesis. {ECO:0000269|PubMed:15707978}.
Induction：Up-regulated during sexual maturation and dowm-regulated by experimental cryptorchidism and heat stress. {ECO:0000269|PubMed:15707978}.
Developmental stage：
Protein families：