UCP1_MOUSE P12242
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P12242
Recommended name：Mitochondrial brown fat uncoupling protein 1
EC number：
Alternative names：(UCP 1) (Solute carrier family 25 member 7) (Thermogenin)
Cleaved into：
GeneID：22227
Gene names (primary )：Ucp1
Gene names (synonym )：Slc25a7 Ucp
Gene names (ORF )：
Length：307
Mass：33248
Sequence：MVNPTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVASFLRLGSWNVIMFVCFEQLKKELMKSRQTVDCTT
Tissue specificity：Expressed in brown adipose tissue. {ECO:0000269|PubMed:8264627}.
Induction：Up-regulated in response to cold in brown adipose tissue where it may regulate non-shivering thermogenesis (at protein level) (PubMed:20466728, PubMed:25578880). Up-regulated by high-fat diet (at protein level) (PubMed:19187776). {ECO:0000269|PubMed:19187776, ECO:0000269|PubMed:20466728, ECO:0000269|PubMed:25578880}.
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family