CD81_MOUSE P35762
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35762
Recommended name：CD81 antigen
EC number：
Alternative names：(26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (CD antigen CD81)
Cleaved into：
GeneID：12520
Gene names (primary )：Cd81
Gene names (synonym )：Tapa1
Gene names (ORF )：
Length：236
Mass：25815
Sequence：MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTSLLYLELGNKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
Tissue specificity：Expressed in oocytes (at protein level) (PubMed:16380109, PubMed:17290409, PubMed:23213457). Highly expressed in granulosa cells (PubMed:16380109). Expressed in skeletal muscle mainly in endothelial cells of endomysial capillaries, in satellite cells and myoblasts (at protein level) (PubMed:23575678). Expressed in hepatocytes (at protein level) (PubMed:12483205). {ECO:0000269|PubMed:12483205, ECO:0000269|PubMed:16380109, ECO:0000269|PubMed:17290409, ECO:0000269|PubMed:23213457, ECO:0000269|PubMed:23575678}.
Induction：Up-regulated in response to notexin-induced acute myoinjury. {ECO:0000269|PubMed:23575678}.
Developmental stage：
Protein families：Tetraspanin (TM4SF) family