GOLM1_MOUSE Q91XA2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91XA2
Recommended name:Golgi membrane protein 1
EC number:
Alternative names:(Golgi membrane protein GP73) (Golgi phosphoprotein 2)
Cleaved into:
GeneID:105348
Gene names (primary ):Golm1
Gene names (synonym ):Golph2
Gene names (ORF ):
Length:393
Mass:44326
Sequence:MMGLGNGRRSMKSPPLILAALVACVIVLGFNYWIASSRSVELQTRIVELEGRVRRAAAERGAVELKKNEFQGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAVLVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQFQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEEVPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNEETNEIQAVGEEHQQASIQGQAVADGTRVGAEKLDQHTQLPAGLLARPEEDSQYPEREQLVIRDRQEQQRASEEGGGQKNPGDEYDMDENEAESEREKQAALAGNDRNINVLNADAQKRGIINVPVGSERQSHILNQVGIHIPQQA
Tissue specificity:
Induction:Up-regulated in response to viral infection. {ECO:0000250|UniProtKB:Q8NBJ4}.
Developmental stage:
Protein families:GOLM family