SH22A_MOUSE   Q9QXK9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QXK9

Recommended name:SH2 domain-containing protein 2A

EC number:

Alternative names:(Lck-associated adapter protein) (Lad) (Rlk/Itk-binding protein) (Ribp)

Cleaved into:

GeneID:27371

Gene names  (primary ):Sh2d2a

Gene names  (synonym ):Lad Ribp

Gene names  (ORF ):

Length:374

Mass:40953

Sequence:MEFCLAQPCPQGNHEATSSTFNTFQPMNLTQGRCQNLSCGSRPSMQVMKEQGVQLSPRTNHTVVSASAPGTAWVLGNADRAEEVPGKGDLSLQAETRAWVQKTQAHWLLLKTAPLWFHGFITRREAERLLQPQPLGCYLVRFSESAVTFVLSYRSQTCCRHFLLAQLGDGRHVVLGEDSAHAQLQDLLEHYTECPLSPYGEILTQPLARQTAEPAGLSLRADSDSGSKRQDPDTQLSLLLQQGQAQASGHTEKVWASQQKATSQASRPRPPIPAKPQLPPEVYTSPASRLHQAPPINPIYQEPDEPIAFYAMGRGSPGDAPSNIYAEVEGPSGTAPIGHPILRKCWSRPISRGQVREVQGKISSRSRAERGSPS

Tissue specificity:Expression limited to tissues of the immune system and, in particular, activated T-cells and natural killer cells. Expressed in the thymus, lymph node, and to a lesser extent, in the spleen and bone marrow. According to PubMed:10553045, also expressed in the lung.

Induction:Up-regulated substantially after T-cell activation.

Developmental stage:

Protein families:


   💬 WhatsApp