BHA09_MOUSE Q5RJB0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5RJB0
Recommended name：Class A basic helix-loop-helix protein 9
EC number：
Alternative names：(bHLHa9) (Class B basic helix-loop-helix factor 42) (bHLHf42)
Cleaved into：
GeneID：320522
Gene names (primary )：Bhlha9
Gene names (synonym )：Bhlhf42
Gene names (ORF )：
Length：231
Mass：25115
Sequence：MLRGTPGLGLGGLNRAEDFVEDLGRSCSEAGRNFGVLRRSSLDEAEEAAGRKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKIATLRRAIHRITALSLVLRASPAPRWPCGHLECHGQAAQGSSTGNSSFSVPRSAPSPIAPSLTRRDIASPLVPPTPRCASCSPHSHLGRPRVMAEVPNLAQTSGGNWRQCPGAPPVRPVSWRWGSGLGYQHS
Tissue specificity：
Induction：
Developmental stage：At 10.5 dpc, expressed in forelimb and hindlimb buds, in the distal mesenchyme below the apical ectodermal ridge. At 11.5 dpc, expression is restricted to the subridge mesenchymal layer, as well as in the dorsal and ventral regions of the developing limbs. {ECO:0000269|PubMed:22147889}.
Protein families：