RN128_MOUSE Q9D304
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D304
Recommended name：E3 ubiquitin-protein ligase RNF128
EC number：EC 2.3.2.27
Alternative names：(Gene related to anergy in lymphocytes protein) (Goliath-related E3 ubiquitin-protein ligase 1) (RING finger protein 128) (RING-type E3 ubiquitin transferase RNF128)
Cleaved into：
GeneID：66889
Gene names (primary )：Rnf128
Gene names (synonym )：Grail Greul1
Gene names (ORF )：MNCb-3816
Length：428
Mass：46276
Sequence：MGPPPGIGVYCRGGCGAARLLAWCFLLALSPHAPGSRGAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVSGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLASERGASGAVIFNFPGTRNEVIPMSHPGAGDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFIITAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGKLQLRTLKQGDKEIGPDGDSCAVCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEASNTASPHEEDSRSETASSGYASVQGADEPPLEEHAQSANENLQLVNHEANSVAVDVVPHVDNPTFEEDETPDQEAAVREIKS
Tissue specificity：Expressed in brain, kidney, heart, liver, ovary, testis and thymus. Expression increased as early as 4 hours by 5- to 7-fold in anergized cultures as compared to resting or activated cells. {ECO:0000269|PubMed:12705856}.
Induction：Induced under anergic conditions. Up-regulated during T-cell anergy induction following signaling through the T-cell antigen receptor. {ECO:0000250|UniProtKB:Q8TEB7}.
Developmental stage：At 6.0 dpc, expressed in both the extraembryonic endoderm and extraembryonic ectoderm. After the beginning of gastrulation, expression remains extraembryonic, and is mostly confined to the visceral endoderm. At 8.5 dpc, expression appears within the mesodermally derived allantois, and is highly expressed in the epithelial layer of the yolk sac. At 9.5 dpc, expressed in the hindgut and adjoining yolk sac. At stage 10 dpc, appears to be widely expressed throughout the embryo with higher expression within the branchial arches and within intersomitic endothelial cells. {ECO:0000269|PubMed:12705856}.
Protein families：