HMGN5_MOUSE Q9JL35
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JL35
Recommended name：High mobility group nucleosome-binding domain-containing protein 5
EC number：
Alternative names：(Nucleosome-binding protein 1) (Nucleosome-binding protein 45) (NBP-45) (Protein GARP45)
Cleaved into：
GeneID：50887
Gene names (primary )：Hmgn5
Gene names (synonym )：Garp45 Nsbp1
Gene names (ORF )：
Length：406
Mass：45344
Sequence：MPKRKAAGDVSQEPKRRSARLSAMPVPFTPELKPKRASTSRKTKTTNVVEENKDASTIPIPETKPEDVKDECNMENAENGEAKIMEAPIPKMEAEEVKEQINEDTEEDGGEKKEAVAAEAKDDELKANIQDVEKDEDGKEHKDTGEEVEDGKIEEEGLNEKPGTAKSEDAEVSKDEEEKGDNEKGEDGKEEGDEKEEEKDDKEGDTGTEKEVKEQNKEAEEDDGKCKEEENKEVGKEGQPEEDGKEDLHEEVGKEDLHEEDGKEGQPEEDGKEIHHEEDGKEGQPEEDGKEYLHEEDGEEGQPKEDQKEGQPEEDGKEDQPEEDGKEGQCKEDGKEGHHEEGGKEDLHEEDGKEKDGGKEDRKEEGEQEVAVDEGSDENKVEAEEEGAENKDFKQDGEKEEPLSIV
Tissue specificity：Expressed in liver, spleen, lung, heart, kidney, muscle and brain (at protein level). Widely expressed with highest levels in submaxillary gland, thymus, kidney and liver and lowest levels in brain, lung, pancreas and eye. {ECO:0000269|PubMed:10692437, ECO:0000269|PubMed:19748358}.
Induction：
Developmental stage：At 7.5 dpc, expression is detected in the ectoplacental cone but not in embryonic tissues. By 9.5 dpc and 12.5 dpc, strongly expressed in the giant trophoblast, spongiotrophoblast and decidual cells of the placenta (at protein level). At 9.5 dpc and 11.5 dpc, weakly expressed in the developing embryo. {ECO:0000269|PubMed:19160411}.
Protein families：HMGN family