SPY4_MOUSE Q9WTP2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTP2
Recommended name：Protein sprouty homolog 4
EC number：
Alternative names：(Spry-4)
Cleaved into：
GeneID：24066
Gene names (primary )：Spry4
Gene names (synonym )：
Gene names (ORF )：
Length：300
Mass：32523
Sequence：MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMKTSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDTKTSRSDKPF
Tissue specificity：Expressed in the embryo and adult tissues including heart, brain, lung, kidney, and skeletal muscle.
Induction：By FGF signaling.
Developmental stage：At 8 dpc expressed in the lateral plate mesoderm of the primitive streak. At 9.5 and 10.5 dpc expressed in the nasal placodes, maxillary and mandibular processes, posterior part of the hyoid arch and the progress zone of the limb buds and the presomitic mesoderm. At 11.5 dpc expressed in the dorso-lateral region of the somites (mostly in the myotome) and in the otic vesicle. At 11.5 and 12.5 dpc expressed in the distal lung mesenchyme, with a strong expression in the accessory lobe of the lung. {ECO:0000269|PubMed:10330503}.
Protein families：Sprouty family