PR7C1_MOUSE   Q9CRB5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CRB5

Recommended name:Prolactin-7C1

EC number:

Alternative names:(Placental prolactin-like protein O) (PLP-O) (PRL-like protein O)

Cleaved into:

GeneID:67505

Gene names  (primary ):Prl7c1

Gene names  (synonym ):Prlpo

Gene names  (ORF ):

Length:251

Mass:29258

Sequence:MLLSLTHPSFLAMLPMLLMSNLLQWEGVTSASIHHIEDDYGEAYLKDLFDQAIKLSNDTMALTIEMRMIFFSDGFSSNMFRKIVLDFLKDHKHMIETLNSCHTFSLSVPETLEEARKISLEDFLKIIVSILNSWNKPLYHLETELHCMKGAPDAILIRANAIRTLNRELLETILMILSRVHPGMEENTDYPLWTDLASLQATNKERQFFALYKLFYCLRVDTFTVDHYLKYLMCMLYSDDICTSVKFYEDP

Tissue specificity:Expressed exclusively in the placenta. Expressed in spongiotrophoblast cells and trophoblast giant cells of the junctional zone and in labyrinthine trophoblast. {ECO:0000269|PubMed:12488360}.

Induction:

Developmental stage:Detectable throughout the second half of gestation. {ECO:0000269|PubMed:12488360}.

Protein families:Somatotropin/prolactin family


   💬 WhatsApp