GPRL1_MOUSE   Q9DAG6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DAG6

Recommended name:GLIPR1-like protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:69286

Gene names  (primary ):Glipr1l1

Gene names  (synonym ):

Gene names  (ORF ):

Length:236

Mass:27074

Sequence:MALKKKLNFLWTLVLYLIASRLPKAFGKDLPRVPTITDPKFIDAFLNIHNELRRKVQPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVINWYNESKYFNFDFNTCSEMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMCGQKTCENSLCRPMNRKTPHHKAACHVLVLGFILQSLL

Tissue specificity:Expressed in testis (at protein level). Little or no expression in other tissues tested. {ECO:0000269|PubMed:20219979}.

Induction:

Developmental stage:Detected at postnatal day 14 in developing testis (at protein level). Detected from postnatal day 18 onwards, with increasing levels through to postnatal day 36. {ECO:0000269|PubMed:20219979}.

Protein families:CRISP family


   💬 WhatsApp