KCNK1_MOUSE O08581
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08581
Recommended name:Potassium channel subfamily K member 1
EC number:
Alternative names:(Inward rectifying potassium channel protein TWIK-1)
Cleaved into:
GeneID:16525
Gene names (primary ):Kcnk1
Gene names (synonym ):
Gene names (ORF ):
Length:336
Mass:38201
Sequence:MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDLVHIMEHDQLSFSSVTEQVAGLKEEQKQSEPFVASQSPPYEDGSADH
Tissue specificity:Detected in spiral ganglion neurons (PubMed:17079103). Detected in hippocampus CA1 and CA1 regions and in the molecular layer of the dentate gyrus (PubMed:24368895, PubMed:25406588). Detected on hippocampus astrocytes (PubMed:24368895, PubMed:24496152). Highly expressed in the stria vascularis in the cochlea (PubMed:12855359). Detected in pancreas islet beta cells (PubMed:22431633). Detected in kidney, at brush border membranes in proximal tubules and in cytoplasmic structures in distal convoluted tubules, thick ascending limbs and collecting ducts (at protein level) (PubMed:15540117, PubMed:16025300). Widely expressed. Detected in spiral ganglion cells (PubMed:17079103). Highest expression in brain, kidney, thyroid, salivary gland, adrenal gland, prostate, epididymis, uterus, placenta, colon and jejunum. Moderate expression in eyes, pituitary, pancreas, smooth muscle, testis and ovary. Very low levels in lung, aorta, liver, heart, skeletal muscle, thymus and spleen. In the brain, highest expression in cerebellar granule cells, brainstem, hippocampus and cerebral cortex (PubMed:18222039). {ECO:0000269|PubMed:15540117, ECO:0000269|PubMed:16025300, ECO:0000269|PubMed:18222039, ECO:0000269|PubMed:22431633, ECO:0000269|PubMed:24368895, ECO:0000269|PubMed:25406588, ECO:0000269|PubMed:9013852, ECO:0000269|PubMed:9559671}.
Induction:
Developmental stage:Detected at very low levels in the embryonic central nervous system (PubMed:9559671, PubMed:18222039). Detected as early as 7 days post conception (PubMed:9559671). Detected in dorsal root ganglia, hippocampus, olfactory epithelia and intestine at 19 dpc (PubMed:18222039). Expression in the brain increases strongly 3-8 days after birth, a period of intense postnatal brain development (PubMed:9559671, PubMed:18222039). Detected in dentate granule cells; expression levels show no significant variability during postnatal development (PubMed:18222039). Expression is higher in adults than in neonates (PubMed:9559671, PubMed:18222039). {ECO:0000269|PubMed:18222039, ECO:0000269|PubMed:9559671}.
Protein families:Two pore domain potassium channel (TC 1.A.1.8) family