SYT1_MOUSE   P46096


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P46096

Recommended name:Synaptotagmin-1

EC number:

Alternative names:(Synaptotagmin I) (SytI) (p65)

Cleaved into:

GeneID:20979

Gene names  (primary ):Syt1

Gene names  (synonym ):

Gene names  (ORF ):

Length:421

Mass:47418

Sequence:MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

Tissue specificity:Expressed in the brain and adrenal medulla (at protein level). {ECO:0000269|PubMed:17190793}.

Induction:

Developmental stage:Detected in the brain at 18 days post coitum (dpc) (at protein level). Expression increases after birth, with expression increasing till adulthood. {ECO:0000269|PubMed:17190793}.

Protein families:Synaptotagmin family


   💬 WhatsApp