FSCN2_MOUSE Q32M02
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q32M02
Recommended name：Fascin-2
EC number：
Alternative names：(Retinal fascin)
Cleaved into：
GeneID：238021
Gene names (primary )：Fscn2
Gene names (synonym )：
Gene names (ORF )：
Length：492
Mass：55073
Sequence：MPTNGLHQVLKIQFGLVNDADRYLTAESFGFKVNASAASLKRKQIWVLEPDPGQGTAVLFRSSHLGRYLSAEEDGRVACEMDQPGRDCRFLVLPQPDGRWVLQSEPHGRFFGGIEDRLSCFATAISPAELWTVHLAIHPQAHLLSVSRRRYVHLCLQEDEMAADGDMPWGVDALVTLIFQSRRYCLKSYDSRYLRSDGRLVWEPEAHACYTLEFKAGKLAFKDCDGRYLAPVGPAGTLKAGRNTRPSKDELFDLEQSHPQVVLVAANRRYISVRQGINVSANQDEELGHETFLMQIDQETKKCTFYSSTGGYWTLVTHGGIQATATQVSANTMFEIEWHGRRVALKASNGRFVCMKKNGQLAAISDFVGEDELFTLKLINRPLLVLRGLDGFVCHRRGSNQLDTNRSTYDVFHLSFRDGAYQIRGRGGGFWYTGSHGSVCSDGDLAEDFLFEFRERGRLAIRALSGKYLRGGASGLLRADADLPVGEALWEY
Tissue specificity：Expressed in the inner ear. Abundant in the utricle. {ECO:0000269|PubMed:27811163}.
Induction：
Developmental stage：Developmentally regulated, appearing in inner-hair cell stereocilia during final stages of elongation.
Protein families：Fascin family