ZFP1_MOUSE   P08042


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P08042

Recommended name:Zinc finger protein 1

EC number:

Alternative names:(Zfp-1) (Protein mKR1)

Cleaved into:

GeneID:22640

Gene names  (primary ):Zfp1

Gene names  (synonym ):Fnp-1 Zfp-1

Gene names  (ORF ):

Length:402

Mass:46511

Sequence:MGSQGSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADGQVERDPRDLQRQVGSLTTIKNQPPTEERGSRFGKTLTLNTDFVSLRQVPYKYDLYEKTLKYNSDLLSSRNCVRKKGDGCGGFGEPLLYLKQEKPHAGLEYSEYNGNGRALSHKDAIFKHRKIKSLVQPFVCNYCDKTFSFKSLLVSHKRIHTGEKPYECDVCQKTFSHKANLIKHQRIHTGEKPFECPECGKAFTHQSNLIVHQRAHMEKKPYGCSECGKTFAQKFELTTHQRIHTGERPYECNECAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHRRTHTGEKPYECTECGKTFSQRSTLRLHLRIRTGEKPYECAECGKAFSRKSRLSVHQRVHMA

Tissue specificity:

Induction:

Developmental stage:Expressed at peak level in day 12 embryos (PubMed:2574853). Isoform 1: Maternally contributed and highly expressed at the zygotic stage, with rapidly decreasing expression at the two cell stage remaining consistently low through to morula stage (PubMed:20624068). {ECO:0000269|PubMed:20624068, ECO:0000269|PubMed:2574853}.

Protein families:Krueppel C2H2-type zinc-finger protein family


   💬 WhatsApp