LYNX1_MOUSE P0DP60
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0DP60
Recommended name：Ly-6/neurotoxin-like protein 1
EC number：
Alternative names：(GC26)
Cleaved into：
GeneID：23936
Gene names (primary )：Lynx1
Gene names (synonym )：
Gene names (ORF )：
Length：116
Mass：12835
Sequence：MTHLLTVFLVALMGLPVAQALECHVCAYNGDNCFKPMRCPAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYYLCNGAGFATPVTLALVPALLATFWSLL
Tissue specificity：Expressed in neurons of multiple regions in the CNS, including the cerebral cortex, thalamus, substantia nigra, cerebellum, amygdala and hippocampus (PubMed:10402197, PubMed:11906696). Also expressed in kidney, heart and thymus, but at lower levels than in the brain (PubMed:10402197). Expressed in the primary visual cortex (V1) and the lateral geniculate nucleus (at protein level) (PubMed:21071629). {ECO:0000269|PubMed:10402197, ECO:0000269|PubMed:11906696, ECO:0000269|PubMed:21071629}.
Induction：
Developmental stage：Expressed at very low levels at birth and undergoes a marked up-regulation between postnatal days 10 and 20 (PubMed:10402197). Up-regulated in the visual cortex between postnatal day 28 (P28) and P60, when experience-dependent brain plasticity declines (PubMed:21071629). {ECO:0000269|PubMed:10402197, ECO:0000269|PubMed:21071629}.
Protein families：