OVOL2_MOUSE Q8CIV7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CIV7
Recommended name：Transcription factor Ovo-like 2
EC number：
Alternative names：(mOvo2) (Zinc finger OVO2) (Zinc finger protein 339) (Zinc finger protein mOVO)
Cleaved into：
GeneID：107586
Gene names (primary )：Ovol2
Gene names (synonym )：Ovo2 Zfp339 Znf339
Gene names (ORF )：
Length：274
Mass：30685
Sequence：MPKVFLVKRRSPGVSVRSWDELPDDKRADTYIPVSLGCLLRDPPEDCRSDGGSSSGCSSSAGEPGGAESSSSPRAPEPETPELHDAQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHNCDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKKLAALMQNKLTSPLQENSTLSEEEEKK
Tissue specificity：Expressed highly in testis, specifically in spermatocytes. Expressed also in skin and at lower levels in the ovary. {ECO:0000269|PubMed:12213202, ECO:0000269|PubMed:15225875, ECO:0000269|PubMed:9468311}.
Induction：Down-regulated during embryonic stem cell neural differentiation and up-regulated by BMP4. {ECO:0000269|PubMed:23319585}.
Developmental stage：Expressed during early-mid embryogenesis, particularly in the inner cell mass at 3.5 dpc, in epiblast at 6.5 dpc, and at later stages in ectodermally derived tissues such as the rostral surface ectoderm (PubMed:16423343). Expressed in embryonic stem cells, epiblasts of 6.4 dpc embryos and primordial germ cells (PGCs) (PubMed:28059165). High expression levels in PGCs of 8.5 dpc embryos decrease over embryogenesis (PubMed:28059165). Up-regulated during prepupertal testis development (PubMed:15225875). {ECO:0000269|PubMed:15225875, ECO:0000269|PubMed:16423343, ECO:0000269|PubMed:28059165}.
Protein families：Krueppel C2H2-type zinc-finger protein family