H31_MOUSE P68433
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P68433
Recommended name：Histone H3.1
EC number：
Alternative names：
Cleaved into：
GeneID：319152
Gene names (primary )：H3c1; H3c8; H3c10; H3c11
Gene names (synonym )：H3a Hist1h3a; H3.1-221 H3g Hist1h3g; H3.1-291 H3h Hist1h3h; H3.1-I H3i Hist1h3i
Gene names (ORF )：; ; ;
Length：136
Mass：15404
Sequence：MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Tissue specificity：
Induction：
Developmental stage：Expressed during S phase, then expression strongly decreases as cell division slows down during the process of differentiation. {ECO:0000269|PubMed:3018484}.
Protein families：Histone H3 family