SYNG1_MOUSE A2ANU3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A2ANU3
Recommended name：Synapse differentiation-inducing gene protein 1
EC number：
Alternative names：(SynDIG1) (Dispanin subfamily C member 2) (DSPC2) (Transmembrane protein 90B)
Cleaved into：
GeneID：433485
Gene names (primary )：Syndig1
Gene names (synonym )：Tmem90b
Gene names (ORF )：
Length：258
Mass：28456
Sequence：MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDFHQASTSSRRALFLAVLSITIGTGIYVGVAVALIAYLSKNNHL
Tissue specificity：Brain-specific. Expressed in Purkinje neurons in cerebellum. Also detected in the hippocampus. Found at excitatory synapses and postsynaptic cells. {ECO:0000269|PubMed:12408845, ECO:0000269|PubMed:20152115}.
Induction：
Developmental stage：Expressed during synaptogenesis. Found at the cell surface of excitatory synapses. {ECO:0000269|PubMed:20152115}.
Protein families：CD225/Dispanin family