PO3F1_MOUSE P21952
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P21952
Recommended name：POU domain, class 3, transcription factor 1
EC number：
Alternative names：(Octamer-binding protein 6) (Oct-6) (Octamer-binding transcription factor 6) (OTF-6) (POU domain transcription factor SCIP)
Cleaved into：
GeneID：18991
Gene names (primary )：Pou3f1
Gene names (synonym )：Oct6 Otf-6 Otf6 Scip
Gene names (ORF )：
Length：449
Mass：45324
Sequence：MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGGSASPPSAPPPPPPAALHHHHHHTLPGSVQ
Tissue specificity：
Induction：
Developmental stage：Expressed in embryonal stem cells and in the developing brain (PubMed:1979677). Down-regulated in embryonic stem cells upon differentiation (PubMed:1979677). Expressed in the sciatic nerves at postnatal days P6 to P12 (PubMed:10068633). {ECO:0000269|PubMed:10068633, ECO:0000269|PubMed:1979677}.
Protein families：POU transcription factor family, Class-3 subfamily