CTF2_MOUSE P83714
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P83714
Recommended name：Cardiotrophin-2
EC number：
Alternative names：(CT-2) (Neuropoietin) (Np)
Cleaved into：
GeneID：244218
Gene names (primary )：Ctf2
Gene names (synonym )：Gm494
Gene names (ORF )：
Length：204
Mass：22000
Sequence：MYCLLATPLCLLSLLLPPLSPAAPISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Tissue specificity：Not detected in adult tissues.
Induction：
Developmental stage：Expressed in embryonic life, with a dramatic peak at day 11 of gestation. At 10 dpc, it is prominently expressed in cells scattered throughout all neuroepithelia, it is also detectable in cranial and dorsal root sensory ganglia, and spinal cord. At 14 dpc, outside the nervous system, it is detectable in vibrissae, dermis, and to a lesser extent in skeletal muscle, lung, and kidney.
Protein families：IL-6 superfamily