LRA25_MOUSE   Q9QUI1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QUI1

Recommended name:Leucine repeat adapter protein 25

EC number:

Alternative names:(C184L ORF2 protein) (C184M protein) (MMTV receptor)

Cleaved into:

GeneID:17826

Gene names  (primary ):Fam89b

Gene names  (synonym ):C184m Lrap25 Mtvr2

Gene names  (ORF ):

Length:189

Mass:20140

Sequence:MNGLPATEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGSANSGSAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQDYKHLCQDLSLCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFQISL

Tissue specificity:Widely expressed. Expressed in the early postnatal brain. {ECO:0000269|PubMed:10512749, ECO:0000269|PubMed:9525630}.

Induction:

Developmental stage:Expressed in forebrain at 16 dpc. {ECO:0000269|PubMed:10512749}.

Protein families:FAM89 family


   💬 WhatsApp