DMRTD_MOUSE   Q8CGW9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CGW9

Recommended name:Doublesex- and mab-3-related transcription factor C2

EC number:

Alternative names:(Doublesex- and mab-3-related transcription factor 7)

Cleaved into:

GeneID:71241

Gene names  (primary ):Dmrtc2

Gene names  (synonym ):Dmrt7

Gene names  (ORF ):

Length:370

Mass:39095

Sequence:MDPSETAALHHCSADSSPADEARVPQSTELIPRRPVSRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKRHLAQGLMKGATPLKAPLRVKKGAIRPGIPSGKENIAPQPQSPHGAVPLVLTPPGKENYGPLLLSRPPEALPLPWTPVPPGPWGPGHWLPPGLSMPPPVVCRLLCQEPAVPLHPFPGFDPGTSLRLPTHGTLPTCPGSRSVLTAPLSGEPQGPPNLPHTCSTLILQSCGTPDSLLLQPQAPGASCLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWISLLHPCGPPAPPGGRGFQPVGPPLRPSPGSSVSLHIGRLGSISLLS

Tissue specificity:Expressed in testis. Highly expressed in ovary.

Induction:

Developmental stage:Expressed in gonads from 11.5 dpc.

Protein families:DMRT family


   💬 WhatsApp