BPIA5_MOUSE Q9CQX3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQX3
Recommended name：BPI fold-containing family A member 5
EC number：
Alternative names：(BPI fold-containing family A member Pluncl) (Palate lung and nasal carcinoma-like protein) (Short palate lung and nasal clone protein 5) (Tongue plunc-like protein) (TPL)
Cleaved into：
GeneID：67135
Gene names (primary )：Bpifa5
Gene names (synonym )：Pluncl Splunc5
Gene names (ORF )：
Length：270
Mass：29175
Sequence：MFLAGSFIVLCGLLAQSTAQLAGLPYPLGQDLPMSMGHCRSLHVGQTLPYYGVTPVVSTYPSDHLDRNFRDAFRHGLLSGGILSFLEHIPLLNYVRPTGSNAGGLVGVLGKVISSIPLLNNILDIRVTNPQLLEIGLVQSYDFHRLYVTIPLGFDLRVNTLVVGSLLELSVKLDVTAEVYAVRDSYGRSRLVIGDCIYPPGSLRISLLNRLGPLQNLIDSLTDILTRVIPGLVQGVVCPLVNGVLSLLDVTLAHDVADALLRGVQFVIKT
Tissue specificity：Expressed in interpapillar epithelium of the anterior part of the tongue. {ECO:0000269|PubMed:15028288}.
Induction：
Developmental stage：Expressed in juvenile and adult mice from postnatal day 2. {ECO:0000269|PubMed:15028288}.
Protein families：BPI/LBP/Plunc superfamily, Plunc family