GBB2_MOUSE P62880
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62880
Recommended name：Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
EC number：
Alternative names：(G protein subunit beta-2) (Transducin beta chain 2)
Cleaved into：
GeneID：14693
Gene names (primary )：Gnb2
Gene names (synonym )：
Gene names (ORF )：
Length：340
Mass：37331
Sequence：MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Tissue specificity：
Induction：
Developmental stage：Expressed in meiotically incompetent oocytes. Expression increases in fully grown meiotically competent oocytes. Expression then decreases during metaphase-II arrested eggs, one-cell embryo, two-cell embryo and eight-cell embryo stages, and increases again during blastocyst stage. {ECO:0000269|PubMed:8858601}.
Protein families：WD repeat G protein beta family