IFG15_MOUSE Q9ER81
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ER81
Recommended name：Torsin-1A-interacting protein 2, isoform IFRG15
EC number：
Alternative names：(15 kDa interferon-responsive protein) (IFRG15)
Cleaved into：
GeneID：240832
Gene names (primary )：Tor1aip2
Gene names (synonym )：Ifrg15
Gene names (ORF )：
Length：131
Mass：15278
Sequence：MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKKIHDSRVAGFNPALQLILSRTDKTLNKKLGQSK
Tissue specificity：
Induction：Induced by interferon alpha. {ECO:0000269|Ref.1}.
Developmental stage：Expressed in oocytes and preimplantation embryos with expression peaking at the blastocyst stage.
Protein families：