MSRB3_MOUSE   Q8BU85


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BU85

Recommended name:Methionine-R-sulfoxide reductase B3, mitochondrial

EC number:EC 1.8.4.12

Alternative names:(MsrB3) (EC 1.8.4.14)

Cleaved into:

GeneID:320183

Gene names  (primary ):Msrb3

Gene names  (synonym ):

Gene names  (ORF ):

Length:253

Mass:26832

Sequence:MPPAAPSVARSREGGGIGQRRLVFPKSARRTLPCPIALCLGLCLAAAAATTTRASAAAFASAGDTTAMSAFNLLHLVTKSQPVAPRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPAFHDVISSEAIEFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSASLSFTPADSSEAEGSGIKESGSPAAADRAEL

Tissue specificity:Widely expressed. Detected in the sensory epithelia of the organ of Corti and vestibular end organs as early as P2 up to adulthood (at protein level). In the organ of Corti, present in inner and outer hair cells and, to a lesser extent, in supporting cells (at protein level). In hair cells, distributed throughout the cell body. Barely detectable level in stereocilia. Also observed in spiral ganglion neurons, but not in the stria vascularis. In the vestibular end organs, found throughout the sensory epithelium, but more intense expression in hair cells than in supporting cells (at protein level). In vestibular hair cells, present within cell bodies and to a lesser extent in kinocilia. Barely detectable in stereocilia. {ECO:0000269|PubMed:21185009}.

Induction:

Developmental stage:Expressed in temporal bones at 15 dpc through postnatal 30, levels decrease thereafter, but is still present in the inner ear at P180.

Protein families:MsrB Met sulfoxide reductase family


   💬 WhatsApp