RHES_MOUSE P63032
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63032
Recommended name:GTP-binding protein Rhes
EC number:
Alternative names:(Ras homolog enriched in striatum)
Cleaved into:
GeneID:75141
Gene names (primary ):Rasd2
Gene names (synonym ):
Gene names (ORF ):
Length:266
Mass:30197
Sequence:MMKTLSSGNCTLNVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAMEAELLVSGDENCAYFEVSAKKNTNVNEMFYVLFSMAKLPHEMSPALHHKISVQYGDAFHPRPFCMRRTKVAGAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCSIQ
Tissue specificity:Highly expressed in brain; prominently in the striatum and weakly in kidney, thyroid, lung, heart and testis. Not expressed in liver. Expressed in pancreatic cell lines and in a embryonic stem cell line. {ECO:0000269|PubMed:15199135, ECO:0000269|PubMed:16945334}.
Induction:Down-regulated in hypothyroid conditions and up-regulated by glibenclamide. {ECO:0000269|PubMed:16945334, ECO:0000269|PubMed:18585460}.
Developmental stage:Expressed in the brain from 13.5 dpc. {ECO:0000269|PubMed:15199135}.
Protein families:Small GTPase superfamily, RasD family