SACA9_MOUSE Q7TPM5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TPM5
Recommended name：Sperm acrosome-associated protein 9
EC number：
Alternative names：(Acrosome and sperm tail protein) (MAST)
Cleaved into：
GeneID：69987
Gene names (primary )：Spaca9
Gene names (synonym )：
Gene names (ORF )：
Length：168
Mass：19482
Sequence：MNEVKESLRSIEQKYKLFQQQQFTFIAALEHCRENAHDKIRPISSIEQVQSYMEHYCNNSTHRRILIMFMDICSELSKLCQHFEALHSGTPVTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLIPIVLDFMKEWIAHSEKLPRKVLQHGTT
Tissue specificity：Expressed in sperm (at protein level) (Ref.4). Expressed from almost all the cell types of testis, with abundant expression in round and elongated spermatids (at protein level) (PubMed:24256100). Predominantly expressed in tissues containing motile cilia (PubMed:27914912). {ECO:0000269|PubMed:24256100, ECO:0000269|PubMed:27914912, ECO:0000269|Ref.4}.
Induction：Expression is activated by FOXJ1 and NOTO. {ECO:0000269|PubMed:27914912}.
Developmental stage：Expressed in the developing fetal lung epithelium (at protein level). {ECO:0000269|PubMed:27914912}.
Protein families：