RGMB_MOUSE   Q7TQ33


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TQ33

Recommended name:RGM domain family member B

EC number:

Alternative names:(DRG11-responsive axonal guidance and outgrowth of neurite) (DRAGON)

Cleaved into:

GeneID:68799

Gene names  (primary ):Rgmb

Gene names  (synonym ):

Gene names  (ORF ):

Length:436

Mass:47181

Sequence:MGVRAAPSCAAAPAAAGAEQSRRPGLWPPSPPPPLLLLLLLSLGLLHAGDCQQPTQCRIQKCTTDFVALTAHLNSAADGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCNYHSHGGVREHGGGDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSCGGCRDLPVGLGLTCLILIMFL

Tissue specificity:Detected in neonatal and adult dorsal root ganglion sensory neurons, spinal cord, and brain (at protein level). Also expressed at high levels in retinal ganglion cells of developing mouse, extending to the optic nerve (at protein level). Expressed in testis, epididymis, ovary, uterus, and pituitary. {ECO:0000269|PubMed:14985445, ECO:0000269|PubMed:15890774}.

Induction:

Developmental stage:Expressed in the developing nervous system. Expression is restricted to a subset of individual neurons in the mid- and hindbrain regions. At 10.5 dpc, expression level increases and extends further into the forebrain. The segmented pattern of expression becomes more refined and is indicative of peripheral nervous system labelling. Not detected in the area of motoneuron differentiation. Expression could be restricted to postmitotic neurons. Also expressed in fetal dorsal root ganglion, dorsal horn, in the dorsomedial mantle layer of the spinal cord, alar plate of the myelencephalon, marginal layer of the mesencephalon, basal plate of the pons, and cerebellar primordia, as well as the cortex of the olfactory lobe, retina, and olfactory epithelium. In the developing eye, expressed in differentiating ganglion cells and later in the development, also in amacrine cells. In adult, expressed in scattered cells throughout the brain. {ECO:0000269|PubMed:14678836, ECO:0000269|PubMed:14749425, ECO:0000269|PubMed:14985445, ECO:0000269|PubMed:15053976, ECO:0000269|PubMed:15671031}.

Protein families:Repulsive guidance molecule (RGM) family


   💬 WhatsApp