PCGF1_MOUSE Q8R023
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R023
Recommended name：Polycomb group RING finger protein 1
EC number：
Alternative names：(Nervous system Polycomb-1) (NSPc1) (RING finger protein 68)
Cleaved into：
GeneID：69837
Gene names (primary )：Pcgf1
Gene names (synonym )：Nspc1 Rnf68
Gene names (ORF )：
Length：259
Mass：30318
Sequence：MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVSQPSGEEPALSNLGLPFSSFDHSKAHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQYSVKEKRR
Tissue specificity：
Induction：
Developmental stage：Expressed in the otic vesicle, urogenital bud and dorsal root ganglia at 10.5 dpc, in the neural tube and neural crest cell derivatives of the peripheral nervous system at 11.5 dpc. {ECO:0000269|PubMed:11287196}.
Protein families：