OPSD_MOUSE   P15409


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P15409

Recommended name:Rhodopsin

EC number:

Alternative names:

Cleaved into:

GeneID:212541

Gene names  (primary ):Rho

Gene names  (synonym ):

Gene names  (ORF ):

Length:348

Mass:39070

Sequence:MNGTEGPNFYVPFSNVTGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVVFTWIMALACAAPPLVGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIFFLICWLPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSIYNPVIYIMLNKQFRNCMLTTLCCGKNPLGDDDASATASKTETSQVAPA

Tissue specificity:Rod-shaped photoreceptor cells in the retina (at protein level). {ECO:0000269|PubMed:15961391, ECO:0000269|PubMed:27353443}.

Induction:

Developmental stage:Expressed in the outer segment of retinal photoreceptors at postnatal days 11 and 22. {ECO:0000269|PubMed:28151698}.

Protein families:G-protein coupled receptor 1 family, Opsin subfamily


   💬 WhatsApp