CITE1_MOUSE P97769
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97769
Recommended name：Cbp/p300-interacting transactivator 1
EC number：
Alternative names：(Melanocyte-specific protein 1)
Cleaved into：
GeneID：12705
Gene names (primary )：Cited1
Gene names (synonym )：Msg1
Gene names (ORF )：
Length：203
Mass：20800
Sequence：MPTMSRPALDVKGGTTSGKEDANQEMNSLAYSNLGVKDRKAVTVLHYPGVTANGAKANGVPTSSSGSTSPIGSPTATPSSKPPSFNLHPTPHLMASMQLQKLNSQYQGAAATAAAALTGAGLPGEEEPMQNWVTAPLVVGGSPGSVSPPAGAQSPALIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSGC
Tissue specificity：Expressed in calvarial osteoblasts. Expressed in nulliparous mammary epithelial cells; absent in pregnant mice and in lacting mammary glands. Also expressed in mammary tumors (at protein level). Expressed only in melanocytes and testis. Expressed at high levels in the strongly pigmented melanoma cells but at low levels in the weakly pigmented cells. {ECO:0000269|PubMed:11581164, ECO:0000269|PubMed:17938205, ECO:0000269|PubMed:18187554}.
Induction：Up-regulated by parathyroid hormone, forskolin and phorbol ester in osteoblasts. {ECO:0000269|PubMed:18187554}.
Developmental stage：Expressed in trophectoderm-derived cells of the placenta. {ECO:0000269|PubMed:14673158}.
Protein families：CITED family