SYCE3_MOUSE B5KM66
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B5KM66
Recommended name:Synaptonemal complex central element protein 3
EC number:
Alternative names:(Testis-specific expressed protein 2) (TSEG-2)
Cleaved into:
GeneID:75459
Gene names (primary ):Syce3
Gene names (synonym ):Tseg2
Gene names (ORF ):
Length:88
Mass:10467
Sequence:MADSDPGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCKEEMEKNWQELLTETKRKQ
Tissue specificity:Expression is restricted to spermatocytes and is absent in spermatogonia, spermatids and spermatogonia (at protein level). Expressed in adult testis and embryonic ovary. Expressed in the convoluted seminiferous tubules in spermatogonia and spermatocytes. {ECO:0000269|PubMed:20407872, ECO:0000269|PubMed:21637789}.
Induction:Up-regulated in cryptorchid testes. {ECO:0000269|PubMed:20407872, ECO:0000269|PubMed:21637789}.
Developmental stage:Expression in pubertal testes is first detected at day 12 coinciding with the onset of prophase I of meiosis (at protein level). Expression in spermatocytes first detected during zygotene when synapsis is initiated and persists on synapsed regions of homologous chromosomes until diplotene. In pachytene oocytes expression is also localized to synapsed chromosomes. {ECO:0000269|PubMed:21637789}.
Protein families: