KLK8_MOUSE Q61955
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61955
Recommended name：Kallikrein-8
EC number：EC 3.4.21.118
Alternative names：(mK8) (Neuropsin) (NP) (Serine protease 19)
Cleaved into：
GeneID：259277
Gene names (primary )：Klk8
Gene names (synonym )：Nrpn Prss19
Gene names (ORF )：
Length：260
Mass：28524
Sequence：MGRPPPCAIQPWILLLLFMGAWAGLTRAQGSKILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
Tissue specificity：Expressed in the limbic system of mouse brain and is localized at highest concentration in pyramidal neurons of the hippocampal CA1-3 subfields. Also detected in spinal cord gray matter and in keratinized stratified epithelia of epidermis, hair, tongue, palate, nasal cavity, pharynges, esophagus and forestomach. In skin and mucus membranes, expressed in stratum spinosum and stratum granulosum. Expressed during estrus in vaginal epithelial cells but not stromal cells. Within the vaginal epithelium, expressed in prickle cells, granular cells and parakeratotic cells but not in basal cells. Not expressed in uterus. Expressed in the keratinocytes. {ECO:0000269|PubMed:12354676, ECO:0000269|PubMed:17629414, ECO:0000269|PubMed:17761692, ECO:0000269|PubMed:7623137, ECO:0000269|PubMed:8602273, ECO:0000269|PubMed:9620300, ECO:0000269|PubMed:9749739}.
Induction：By chemical/incision-induced brain injury which leads to increased expression in axon fiber bundles of the peri-lesioned region, by electrically-induced seizure (kindling) in brain, by UV irradiation in skin and by incisional and chemically-induced skin wounding which causes epidermal proliferation and hyperkeratosis. Induced by chemically-induced oxidative stress which leads to increased expression in the hippocampal pyramidal neurons 2 hours after treatment. Levels then decrease, drop to 60% of pretreated control levels at day 7 when avoidance learning is impaired and return to control levels at day 30. Also induced by spinal crush injury which leads to increased expression in spinal cord white matter adjacent to the lesion. Expression increases between days 1-14 post-injury with a peak at day 4. {ECO:0000269|PubMed:10196465, ECO:0000269|PubMed:10421059, ECO:0000269|PubMed:11274744, ECO:0000269|PubMed:14616360, ECO:0000269|PubMed:17629414, ECO:0000269|PubMed:8864305, ECO:0000269|PubMed:9374276, ECO:0000269|PubMed:9749739}.
Developmental stage：Expression is detected in the brain from embryonic day 12 and continues into adulthood. {ECO:0000269|PubMed:8602273}.
Protein families：Peptidase S1 family, Kallikrein subfamily