SACA6_MOUSE E9Q8Q8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:E9Q8Q8
Recommended name：Sperm acrosome membrane-associated protein 6
EC number：
Alternative names：
Cleaved into：
GeneID：75202
Gene names (primary )：Spaca6
Gene names (synonym )：
Gene names (ORF )：
Length：339
Mass：38503
Sequence：MTSQRSLSSPQTRRPSVMGLISLVGSIVLLFLLIFRASTWACLFCFTTYEERLRVCQLFVGREETKINLCRNELEGAFEDLKDMKINYDERSYLHDEFTQMTVSLQEKAARRREPFWLAFKDAAAKLKRTIEHLKKAPACIPPCGLQEVARLFHCSGCFSKLCDLPLDCPVQDMLVNRGDQALFSCIVAFELPESEITYSWKFVGGVRTKDVTYFRDMPGAHGYLARIRPVQPKHGGTFSCVILHDQRPLARLYFYLNVTGPPPPEDTELQVTFREVMNRTPAEPEMIQPWSPSLGELLTNPQALTLGNLFLLAATAALGSASVTLLVWLFFRWYLSGN
Tissue specificity：Highly expressed in testis (PubMed:24275887, PubMed:32393636). Minor expression also detected in epididymis, seminal vesicle and ovary (PubMed:32393636). Predominantly expressed in testicular germ cells during spermiogenesis (PubMed:24275887). Most abundant in round spermatids and detected at lower levels in elongating spermatids (PubMed:24275887). {ECO:0000269|PubMed:24275887, ECO:0000269|PubMed:32393636}.
Induction：
Developmental stage：Expression is first detected on postnatal day 21. {ECO:0000269|PubMed:32393636}.
Protein families：SPACA6 family