EPAB2_MOUSE Q5XFR0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5XFR0
Recommended name：Embryonic polyadenylate-binding protein 2
EC number：
Alternative names：(Embryonic poly(A)-binding protein 2) (ePABP-2) (ePABP2) (Embryonic poly(A)-binding protein type II) (Poly(A)-binding protein nuclear-like 1)
Cleaved into：
GeneID：382035
Gene names (primary )：Pabpn1l
Gene names (synonym )：Epabp2 Gm1108 Pabpnl1
Gene names (ORF )：
Length：273
Mass：30263
Sequence：MEPYLSNELFPPPTEAWLQTVSSDPEAQGWGAWGRTEKTSLVPRAGSRAGSDKEAEENEDASFLLSLLEPENLAKSPVFNQELEAIKLKLWAMEHAEAQPEPPCVQRKATEEERAEVRQLLSPETVDCFFSRTSKENVEADHRSVFVGNVDYGGSAAELEAYFSPCGEIHRVTILCDKFSGHPKGYAYIEFASHRSVKAAVGLDESTFRGRVIKVLPKRTNFPGISSTDRGGLRTHSGNRAAFLHGSLHRKARLRAHGRSRGHGGAPQWFSPY
Tissue specificity：
Induction：
Developmental stage：Expression is restricted to oogenesis, early embryogenesis and the adult ovary. {ECO:0000269|PubMed:15083517}.
Protein families：