CCNG2_MOUSE O08918
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08918
Recommended name：Cyclin-G2
EC number：
Alternative names：
Cleaved into：
GeneID：12452
Gene names (primary )：Ccng2
Gene names (synonym )：
Gene names (ORF )：
Length：344
Mass：38848
Sequence：MKDLGAKHLAGGEGVQLFGLLNFYLEQEQRYQPREKGLILMEATPENDNTLCSRLRNAKVEDLRSLTNFFGSGTETFVLAVNILDRFLALMKVKPKHLSCIGVCCFLLAARLAEEEGDVPPTHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLYHAIVFCHTSERKEILSLDKLEAQLKACNCRVVFSKARPSVLALCLLNLEIETIKSVELLEILLLVKKHLKLSDTEFFYWRELVSKCLAEYSSPRCCKPDLKKLVWIVSRRTAQNLHSSYYSVPELPTIPEGGCFDGSESEDSGEDMSCGEESLSSSPPSDQECTFFFDFQVAQTLCFPP
Tissue specificity：Highest levels in intestine. Intermediate levels in spleen, brain and kidney. Low levels in testis, stomach, pancreas, liver, salivary gland and muscle. According to PubMed:9139721 also abundant in thymus.
Induction：Activated in B-cells by agents causing growth inhibition or growth arrest.
Developmental stage：Expression levels oscillate moderately through the cell cycle.
Protein families：Cyclin family, Cyclin G subfamily