CXG2_MOUSE   Q8BQU6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BQU6

Recommended name:Gap junction gamma-2 protein

EC number:

Alternative names:(Connexin-47) (Cx47) (Gap junction alpha-12 protein)

Cleaved into:

GeneID:118454

Gene names  (primary ):Gjc2

Gene names  (synonym ):Gja12

Gene names  (ORF ):

Length:440

Mass:47008

Sequence:MTNMSWSFLTRLLEEIHNHSTFVGKVWLTVLVVFRIVLTAVGGESIYSDEQSKFTCNTRQPGCDNVCYDAFAPLSHVRFWVFQIVVISTPSVMYLGYAVHRLARASEQERRRALRRRPGTRRLPRAQLPPPPPGWPDTTDLGEAEPILALEEDEDEEPGAPEGPGEDTEEERAEDVAAKGGGGDGKTVVTPGPAGQHDGRRRIQREGLMRVYVAQLVVRAAFEVAFLVGQYLLYGFEVPPFFACSRQPCPHVVDCFVSRPTEKTVFLLVMYVVSCLCLLLNLCEMAHLGLGSAQDAVRGRRGASAAGPGPTPRPPPCAFPAAAAGLACPPDYSLVVRAAERARAHDQNLANLALQALRDGAAVAAVSADRDSPPCAGLNATSRGAPRVGGLASGTGSATSGGTVGEQSRPGAQEQLATKPRAGSEKGSTGSRDGKATVWI

Tissue specificity:Mainly expressed by oligodendrocytes in the central nervous system (at protein level). {ECO:0000269|PubMed:12805295, ECO:0000269|PubMed:12843301, ECO:0000269|PubMed:15183511}.

Induction:

Developmental stage:Expression starts after birth in the central nervous system and parallels myelination process. {ECO:0000269|PubMed:12843301}.

Protein families:Connexin family, Gamma-type subfamily


   💬 WhatsApp