NMES1_MOUSE Q810Q5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q810Q5
Recommended name：Normal mucosa of esophagus-specific gene 1 protein
EC number：
Alternative names：
Cleaved into：
GeneID：433470
Gene names (primary )：Nmes1
Gene names (synonym )：
Gene names (ORF )：
Length：83
Mass：9584
Sequence：MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR
Tissue specificity：Strongly expressed in vertebrae, brain, intestine and stomach. {ECO:0000269|PubMed:12209954}.
Induction：
Developmental stage：First detected at 8 dpc in the ossification center and the spinal cord. From this stage up to birth, expression extends throughout the bone tissue and strong expression is detected in the vertebrae. At 16 dpc, detected in the developing brain, including the prosencephalon, mesencephalon, diencephalon, telencephalon and rhombencephalon, and in the intestine. Faint expression at 16 dpc in the lung. {ECO:0000269|PubMed:12209954}.
Protein families：Complex I NDUFA4 subunit family