NRSN2_MOUSE   Q5HZK2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5HZK2

Recommended name:Neurensin-2

EC number:

Alternative names:

Cleaved into:

GeneID:228777

Gene names  (primary ):Nrsn2

Gene names  (synonym ):Gm123

Gene names  (ORF ):

Length:202

Mass:22415

Sequence:MSCSRPCVCSHGTSVEESTWYGFDFYPNLFYNDWLGTTTLPYNPERIPIRYINRPWPSLCWKVTVAVASLFLLLGVAALTTGYAVPPKLELVNESKFSSMEDPVADYNQALMTCRVVGATLCGVAGIMLAVCLFLIASGWMFQDIKAEPLVTETDSPVEVFRDEPEKLSPAFHETSSQSPFLTPPSPFGQQSVQTSQPQRDL

Tissue specificity:Expressed specifically in brain where it is widely expressed, with highest levels of expression in thalamus and hypothalamus. In brain, found in neural cell bodies and detected in many regions of the limbic system, such as the septum nucleus, horizontal and vertical limbs of the diagonal band, hippocampus, amygdaloid nucleus, and habernula nucleus. Also localizes to small vesicles found in the perinuclear region of Neuro2a and PC12 cells. {ECO:0000269|PubMed:16527258}.

Induction:

Developmental stage:In cerebral cortex first detected at 15.5 dpc with increasing levels of expression observed during postnatal stages. {ECO:0000269|PubMed:16527258}.

Protein families:VMP family


   💬 WhatsApp